PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013897315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 333aa    MW: 33805.2 Da    PI: 5.2881
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013897315.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding67.22.9e-211055147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+WT+eEd ll+++v+++G+++W++Iar ++ gRt+k+c++rw++ 
   XP_013897315.1 10 KGPWTPEEDALLLRCVAKHGPKNWSLIARSIP-GRTGKSCRLRWLNQ 55
                     79******************************.***********996 PP

2Myb_DNA-binding46.21e-1462106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +++ eEd ++  a+++lG++ W++I++ +  gRt++++k++w++ 
   XP_013897315.1  62 KEPFSGEEDAIIMAAHTLLGNK-WASISKLLV-GRTDNSVKNHWNST 106
                      578999****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.312560IPR017930Myb domain
SuperFamilySSF466898.63E-318103IPR009057Homeodomain-like
SMARTSM007171.9E-19958IPR001005SANT/Myb domain
PfamPF002491.5E-201055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-281163IPR009057Homeodomain-like
CDDcd001672.75E-181254No hitNo description
PROSITE profilePS5129420.07661111IPR017930Myb domain
SMARTSM007171.1E-1261109IPR001005SANT/Myb domain
PfamPF002497.5E-1262106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2264110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MKDYGDELTK GPWTPEEDAL LLRCVAKHGP KNWSLIARSI PGRTGKSCRL RWLNQLNPNV  60
KKEPFSGEED AIIMAAHTLL GNKWASISKL LVGRTDNSVK NHWNSTLKRR RGEYVRGGPL  120
DVSELAAAIE VHLSQRGLDP VADPDEDGAD TNPVIPLLTR FAAKPGDPRA RPPSAGPRPG  180
AAALLGAGSG DDGRGGGMRL PLGLLGDFGA GAGPSGRGGQ RGPHMQWEEV EEEEGDEEDD  240
GEDEEGGGGG GYGGGGPRGM RHASSGLDAV AAAAAAAAAE LQHGGGGGGG GGGGGGADAA  300
AGNGDSSSGS GREEGAIAAA AAAVAAEAMR RRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-4171101104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013897315.10.0Transcription factor MYB44
SwissprotQ9FDW11e-47MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2MVB30.0A0A0D2MVB3_9CHLO; Transcription factor MYB44
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-47myb domain protein 73
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]